Interferonom alfa-inducibilni protein 6 jest protein koji je kod ljudi kodiran genom IFI6 sa hromosoma 1.
Aminokiselinska sekvenca Dužina polipeptidnog lanca je 130 aminokiselina, a molekulska težina 12.927 Da.
1020304050 MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGG LAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLG AGGSSVVIGNIGALMGYATHKYLDSEEDEE Funkcija This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A mini-satellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described.
Reference
Dopunska literatura
Kategorija:Geni na hromosomu 1 Kategorija:Ljudski proteini Kategorija:Proteomika